Recombinant Human TNF Receptor II protein (ab194174)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSD TVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRP GWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNT TSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVST RSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDVDHHHHHH
    • Molecular weight
      26 kDa including tags
    • Amino acids
      23 to 257
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab194174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • CD120b
    • p75
    • p75 TNF receptor
    • p75TNFR
    • p80 TNF alpha receptor
    • p80 TNF-alpha receptor
    • Soluble TNFR1B variant 1
    • TBP-2
    • TBPII
    • TNF R II
    • TNF R2
    • TNF R75
    • TNF-R2
    • TNF-RII
    • TNFBR
    • TNFR-II
    • TNFR1B
    • TNFR2
    • TNFR80
    • TNFRII
    • Tnfrsf1b
    • TNR1B_HUMAN
    • Tumor necrosis factor beta receptor
    • Tumor necrosis factor binding protein 2
    • Tumor necrosis factor receptor 2
    • Tumor necrosis factor receptor superfamily member 1B
    • Tumor necrosis factor receptor type II
    • Tumor necrosis factor-binding protein 2
    see all
  • Function
    Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
  • Sequence similarities
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications
    Phosphorylated; mainly on serine residues and with a very low level on threonine residues.
    A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

References

ab194174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up