Recombinant Human TNFAIP2 protein (ab159728)

Overview

  • Product name
    Recombinant Human TNFAIP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYA TCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSL
    • Amino acids
      552 to 650
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B94
    • EXOC3L3
    • exocyst complex component 3-like 3
    • Primary response gene B94 protein
    • TNAP2_HUMAN
    • TNF alpha-induced protein 2
    • Tnfaip2
    • tumor necrosis factor alpha induced protein 2
    • Tumor necrosis factor alpha-induced protein 2
    • tumor necrosis factor, alpha-induced protein 2 antibody
    see all
  • Function
    May play a role as a mediator of inflammation and angiogenesis.
  • Sequence similarities
    Belongs to the SEC6 family.
  • Developmental stage
    Differentially expressed in development and capillary tube-like formation in vitro.
  • Information by UniProt

Images

  • ab159728 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up