Recombinant human TNFRSF14 protein (Fc Chimera) (ab56291)

Overview

Description

  • NatureRecombinant
  • SourceBTI-TN-5B1-4 cells
  • Amino Acid Sequence
    • AccessionQ92956
    • SpeciesHuman
    • SequenceLPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLN GLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAAC RAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids39 to 184
    • Additional sequence informationFused with the Fc region of Human IgG1 at the C-terminus

Specifications

Our Abpromise guarantee covers the use of ab56291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Biological Activity : Determined by its ability to neutralize 0.25 ng/ml of hTNFbeta induced cytotoxicity on murine L929 cells. The expected ED50 for this effect is 1.3-1.9 µg/ml of TNFRSF14.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.
    Source : Insect cells. Purity : Greater than 98% by SDS-PAGE gel and HPLC analyses. Endotoxin level is less than 0.1 ng per µg (1EU/µg).
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • HVEML
    • ATAR
    • CD270
    • CD40 like protein precursor
    • Herpes virus entry mediator A
    • Herpesvirus entry mediator
    • Herpesvirus entry mediator A
    • Herpesvirus entry mediator ligand
    • HveA
    • HVEM
    • HVEM L
    • LIGHT
    • LIGHTR
    • TNFRSF14
    • TNFSF 14
    • TNR14_HUMAN
    • TR2
    • Tumor necrosis factor receptor like gene2
    • Tumor necrosis factor receptor superfamily member 14
    • Tumor necrosis factor receptor superfamily member 14 precursor
    • Tumor necrosis factor receptor-like 2
    see all
  • FunctionReceptor for BTLA. Receptor for TNFSF14/LIGHT and homotrimeric TNFSF1/lymphotoxin-alpha. Involved in lymphocyte activation. Plays an important role in HSV pathogenesis because it enhanced the entry of several wild-type HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T-cells.
  • Tissue specificityWidely expressed, with the highest expression in lung, spleen and thymus.
  • Sequence similaritiesContains 3 TNFR-Cys repeats.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationMembrane.
  • Information by UniProt

References for Recombinant human TNFRSF14 protein (Fc Chimera) (ab56291)

ab56291 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab56291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"