Recombinant Human TNFRSF18 protein (ab160184)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCC RVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGV QSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHN AVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPR ETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV
    • Amino acids
      1 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activation inducible TNFR family receptor
    • Activation-inducible TNFR family receptor
    • AITR
    • CD357
    • GITR
    • GITR D
    • GITR-D
    • GITRD
    • Glucocorticoid induced TNFR related protein
    • glucocorticoid-induced tnf receptor ligand
    • glucocorticoid-induced tnf receptors ligand
    • Glucocorticoid-induced TNFR-related protein
    • TNF receptor superfamily activation inducible protein
    • TNFRSF 18
    • TNFRSF18
    • TNR18_HUMAN
    • Tumor necrosis factor receptor superfamily member 18
    • Tumor necrosis factor receptor superfamily member 18 precursor
    see all
  • Function
    Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.
  • Tissue specificity
    Expressed in lymph node, peripheral blood leukocytes and weakly in spleen.
  • Sequence similarities
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab160184 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up