Recombinant Human TNFRSF19L protein (ab191989)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWR RLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWG RRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight
      41 kDa including tags
    • Amino acids
      26 to 160
    • Additional sequence information
      Extracellular domain, fused with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 10% Glycerol, 0.03% DTT

General Info

  • Alternative names
    • Receptor expressed in lymphoid tissues
    • Relt
    • TNFRSF19L
    • TR19L_HUMAN
    • Tumor necrosis factor receptor superfamily member 19L
    see all
  • Function
    Mediates activation of NF-kappa-B. May play a role in T-cell activation.
  • Tissue specificity
    Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.
  • Sequence similarities
    Belongs to the RELT family.
    Contains 1 TNFR-Cys repeat.
  • Post-translational
    modifications
    Phosphorylated in vitro by OXSR1.
  • Cellular localization
    Cell membrane. Cytoplasm.
  • Information by UniProt

References

ab191989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up