Recombinant Human TNFSF18 protein (ab113132)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGD TI DLIFNSEHQVLKNNTYWGIILLANPQFIS
    • Molecular weight
      15 kDa
    • Amino acids
      72 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab113132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113132 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3.50
    Constituents: 0.26% Sodium citrate, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Activation inducible TNF related ligand
    • Activation-inducible TNF-related ligand
    • AITR ligand
    • AITRL
    • GITR ligand
    • GITRL
    • Glucocorticoid induced TNF related ligand
    • Glucocorticoid induced TNFR related protein ligand
    • Glucocorticoid-induced TNF-related ligand
    • hGITRL
    • MGC138237
    • TL6
    • TNF18_HUMAN
    • TNFSF18
    • TNLG2A
    • Tumor necrosis factor (ligand) superfamily member 18
    • Tumor necrosis factor ligand 2A
    • Tumor necrosis factor ligand superfamily member 18
    see all
  • Function
    Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.
  • Tissue specificity
    Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human TNFSF18 protein images

  • 15% SDS-PAGE analysis of 3 µg ab113132.

References for Recombinant Human TNFSF18 protein (ab113132)

ab113132 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up