Recombinant Human TNFSF18 protein (ab132518)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQ LETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQ VAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDL IFNSEHQVLKNNTYWGIILLANPQFIS
    • Molecular weight
      47 kDa including tags
    • Amino acids
      23 to 199

Specifications

Our Abpromise guarantee covers the use of ab132518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activation inducible TNF related ligand
    • Activation-inducible TNF-related ligand
    • AITR ligand
    • AITRL
    • GITR ligand
    • GITRL
    • Glucocorticoid induced TNF related ligand
    • Glucocorticoid induced TNFR related protein ligand
    • Glucocorticoid-induced TNF-related ligand
    • hGITRL
    • MGC138237
    • TL6
    • TNF18_HUMAN
    • TNFSF18
    • TNLG2A
    • Tumor necrosis factor (ligand) superfamily member 18
    • Tumor necrosis factor ligand 2A
    • Tumor necrosis factor ligand superfamily member 18
    see all
  • Function
    Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.
  • Tissue specificity
    Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132518 stained with Coomassie Blue.

References

ab132518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up