Recombinant human TNFSF9 protein (ab168048)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQ NVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLE LRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFG FQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL PSPRSE
    • Molecular weight
      27 kDa including tags
    • Amino acids
      49 to 254
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab168048 binds to Human CD137 (4-1BB).
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    ab168048 binds to Human CD137 (4-1BB).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile distilled water for a final concentration of 0.1mg/ml. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. Further dilutions should be made with medium containing 5% fetal calf serum.

General Info

  • Alternative names
    • 4 1BB L
    • 4 1BB ligand
    • 4 1BBL
    • 4-1BB ligand
    • 4-1BBL
    • Cd137l
    • Cd157l
    • Homolog of mouse 4 1BB L
    • Homolog of mouse 4 1BBL
    • ILA ligand (TNF related)
    • Ly63l
    • Receptor 4 1BB ligand
    • TNF superfamily member 9
    • TNFL9_HUMAN
    • Tnfsf9
    • TNLG5A
    • Tumor necrosis factor (ligand) superfamily member 9
    • Tumor necrosis factor ligand 5A
    • Tumor necrosis factor ligand superfamily member 9
    • Tumor necrosis factor superfamily member 9
    see all
  • Function
    Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
  • Tissue specificity
    Expressed in brain, placenta, lung, skeletal muscle and kidney.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Dose-dependent binding of ab168048. Recombinant Human TNFSF9 saturates its receptor at a concentration range of 2-4000ng/ml. Method: Receptor binding assay: a 96-well ELISA plate was coated O/N with 50ng per well of CD137 (Human):Fc (Human) (rec.) (4-1BB:Fc). After a blocking step, the indicated concentrations of ab168048 were added for 1 hour. After extensive washing, an Enhancer was added for 1 hour. Bound ligand was revealed by a rabbit anti-mouse IgG-HRP (1/1000 dilution) incubated for 1 hour. OPD was used as a substrate and absorbance was measured at 490nm in an ELISA reader.

References

ab168048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up