Overview

  • Product nameRecombinant Human TNIP1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15025
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSNVTASPTAPACPSDKPAPVQKPPSSGTS SEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCA EEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEAL KAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGASGRPGSPKMEGT GKKAVAGQQQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQ HFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQRDFDRKLLLAKS KIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKA LEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEED FQRERSDRERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALR QQKRKAKA
    • Molecular weight52 kDa including tags
    • Amino acids94 to 530
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 75 % SDS-PAGE.
    ab101108 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • ABIN 1
    • HIV-1 Nef-interacting protein
    • hVAN
    • KIAA0113
    • Naf1
    • Nef-associated factor 1
    • Nip40-1
    • TNFAIP3 interacting protein 1
    • TNFAIP3-interacting protein 1
    • TNIP-1
    • Tnip1
    • TNIP1_HUMAN
    • VAN
    • Virion-associated nuclear shuttling protein
    see all
  • FunctionInteracts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal (By similarity). Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production.
  • Tissue specificityUbiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain.
  • Cellular localizationCytoplasm. Nucleus. Shuttles between the nucleus and cytoplasm in a CRM1-dependent manner.
  • Information by UniProt

Recombinant Human TNIP1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101108.

References for Recombinant Human TNIP1 protein (ab101108)

ab101108 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"