Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WPERKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEMELSVHWVTHQ ECQTALGATGGDVASAIRNLKVDQLFLLSSRSRADCWRILEHYQWDLSAA SRYVLARP
    • Amino acids
      559 to 666
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD38 negative kinase 1
    • EC 2.7.10.2
    • Kinase of embryonic stem cells
    • Kos 1
    • Kos1
    • MGC46193
    • Non receptor tyrosine protein kinase TNK 1
    • Non receptor tyrosine protein kinase TNK1
    • Non-receptor tyrosine-protein kinase TNK1
    • Tnk 1
    • Tnk1
    • TNK1_HUMAN
    • Tyrosine kinase non receptor 1
    see all
  • Function
    Involved in negative regulation of cell growth. Has tumor suppressor properties. Plays a negative regulatory role in the Ras-MAPK pathway. May function in signaling pathways utilized broadly during fetal development and more selectively in adult tissues and in cells of the lymphohematopoietic system. Could specifically be involved in phospholipid signal transduction.
  • Tissue specificity
    Expressed in all umbilical cord blood, bone marrow and adult blood cell sub-populations and in several leukemia cell lines. Highly expressed in fetal blood, brain, lung, liver and kidney. Detected at lower levels in adult prostate, testis, ovary, small intestine and colon. Not expressed in adult lung, liver, kidney or brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 protein kinase domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Autophosphorylated on tyrosine residues.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab160156 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up