Overview

  • Product nameRecombinant Human TNNC1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP63316
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDDIYKAAVEQLTEEQKNEFKAAFDIFVLG AEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITE DDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
    • Molecular weight21 kDa including tags
    • Amino acids1 to 161
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113126 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Cardiac troponin C
    • CMD1Z
    • CMH13
    • slow skeletal and cardiac muscles
    • Slow twitch skeletal/cardiac muscle troponin C
    • TN-C
    • TNC
    • TNNC
    • Tnnc1
    • TNNC1 troponin C type 1 (slow)
    • TNNC1_HUMAN
    • Troponin C
    • troponin C type 1 (slow)
    • Troponin C, slow skeletal and cardiac muscles
    • Troponin C1, slow
    see all
  • FunctionTroponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
  • Involvement in diseaseDefects in TNNC1 are the cause of cardiomyopathy dilated type 1Z (CMD1Z) [MIM:611879]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in TNNC1 are the cause of cardiomyopathy familial hypertrophic type 13 (CMH13) [MIM:613243]. A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similaritiesBelongs to the troponin C family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Recombinant Human TNNC1 protein images

  • 15% SDS-PAGE analysis of TNNC1 protein (ab113126; 3 µg).

References for Recombinant Human TNNC1 protein (ab113126)

ab113126 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"