Overview

  • Product name
    Recombinant Human TNNT3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQL EIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
    • Amino acids
      161 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMCD2B
    • Beta TnTF
    • Beta-TnTF
    • DA2B
    • DKFZp779M2348
    • fast skeletal muscle
    • Fast skeletal muscle troponin T
    • FSSV
    • fTnT
    • TNNT 3
    • Tnnt3
    • TNNT3_HUMAN
    • TnTf
    • Troponin T
    • Troponin T fast skeletal muscle
    • Troponin T type 3
    • Troponin T type 3 (skeletal fast)
    • Troponin T3 skeletal fast
    see all
  • Function
    Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Tissue specificity
    In fetal and adult fast skeletal muscles, with a higher level expression in fetal than in adult muscle.
  • Involvement in disease
    Defects in TNNT3 are a cause of distal arthrogryposis type 2B (DA2B) [MIM:601680]; also known as arthrogryposis multiplex congenita, distal, type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin.
  • Sequence similarities
    Belongs to the troponin T family.
  • Information by UniProt

Images

  • ab159730 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up