Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGAKPTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQL LQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKDL SPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVL PEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMK VFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSSNLHEAASDCVC SALYA
    • Molecular weight
      93 kDa including tags
    • Amino acids
      1 to 255

Specifications

Our Abpromise guarantee covers the use of ab112402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • TNPO 3
    • Imp12
    • Importin 12
    • Importin-12
    • IPO12
    • MTR10A
    • TNPO3
    • TNPO3_HUMAN
    • Transportin 3
    • Transportin SR
    • Transportin-3
    • Transportin-SR
    • TRN SR
    • TRN-SR
    • TRN-SR2
    • TRNSR
    see all
  • Function
    Seems to function in nuclear protein import as nuclear transport receptor. In vitro, mediates the nuclear import of splicing factor SR proteins SFRS1 and SFRS2, by recognizing phosphorylated RS domains.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human TNPO3 protein images

  • 12.5% SDS-PAGE analysis of ab112402. Stained with Coomassie Blue

References for Recombinant Human TNPO3 protein (ab112402)

ab112402 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up