Overview

  • Product name
    Recombinant Human TNS4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSKASSPHGLGSPLVASPRLEKRLGGLAPQRGSRISVLSASPVSDVSYM FGSSQSLLHSSNSSHQSSSRSLESPANSSSSLHSLGSVSLCTRPSDFQAP RNPTLTMGQPRTPHSPPLAKEHASSCPPSITNSMVDIPIVLINGCPEPGS SPPQRTPGHQNSVQPGAASPSNPCPATRSNSQTLSDAPFTTCPEGPARDM QPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGL ALKVQEVPASAQSRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLS AFVCQHSIMALALPCKLTIPQRELGGADGASDSTDSPASCQKKSAGCHTL YLSSVSVETLTGALAVQKAISTTFERDILPTPTVVHFKVTEQGITLTDVQ RKVFFRRHYPLTTLRFCGMDPEQRKWQKYCKPSWIFGFVAKSQTEPQENV CHLFAEYDMVQPASQVIGLVTALLQDAERM
    • Amino acids
      1 to 480
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C terminal tensin like
    • C terminal tensin like protein
    • C-terminal tensin-like protein
    • CTEN
    • FLJ14950
    • PP14434
    • TENS4_HUMAN
    • Tensin 4
    • Tensin-4
    • Tns4
    see all
  • Function
    May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton (By similarity). May promote apoptosis, via its cleavage by caspase-3.
  • Tissue specificity
    Prostate and placenta. Down regulated in prostate cancer.
  • Sequence similarities
    Contains 1 phosphatase tensin-type domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Proteolytically cleaved by caspase-3 during apoptosis.
  • Cellular localization
    Cell junction > focal adhesion. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab164709 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up