Recombinant Human Tollip protein (ab107146)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9H0E2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMATTVSTQRGPVYIGELPQDFLRITPTQQQ RQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGMTRMDPYCRLR LGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDR IAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMV MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCS EEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
    • Molecular weight32 kDa including tags
    • Amino acids1 to 294
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    Purified by using conventional chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Adapter protein
    • FLJ33531
    • IL 1RAcPIP
    • IL1RAcPIP
    • TOLIP
    • TOLIP_HUMAN
    • Toll interacting protein
    • Toll-interacting protein
    • tollip
    see all
  • FunctionComponent of the signaling pathway of IL-1 and Toll-like receptors. Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Inhibits IRAK1 phosphorylation and kinase activity.
  • Sequence similaritiesBelongs to the tollip family.
    Contains 1 C2 domain.
    Contains 1 CUE domain.
  • Post-translational
    modifications
    Phosphorylated by IRAK1 upon stimulation by IL-1 or microbial products.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Tollip protein images

  • ab107146 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human Tollip protein (ab107146)

ab107146 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"