Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEF DKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA
    • Amino acids
      394 to 491
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ33404
    • OTTHUMP00000028777
    • Target of myb 1
    • Target of Myb protein 1
    • Target of myb1
    • TOM 1
    • TOM1
    • TOM1_HUMAN
    see all
  • Relevance
    Function: May be involved in intracellular trafficking. Probable association with membranes. Tissue specificity: Widely expressed. Highly expressed in skeletal muscle, heart, placenta and liver. Similarity: Belongs to the TOM1 family. Contains 1 GAT domain. Contains 1 VHS domain.
  • Cellular localization
    Cytoplasm. Membrane; Peripheral membrane protein

Images

  • ab160776 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up