Recombinant Human TOM1L1 protein (ab153038)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDAPK DAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKEN
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310045L10Rik
    • C80573
    • OK/KNS CL.3
    • Src activating and signaling molecule
    • Src activating and signaling molecule protein
    • Src-activating and signaling molecule protein
    • SRCASM
    • Target of Myb like protein 1
    • Target of Myb-like protein 1
    • Target of myb1 (chicken) homolog like 1
    • Target of myb1 (chicken) like 1
    • Target of myb1 like 1
    • TM1L1_HUMAN
    • TOM1 L1
    • TOM1 like protein 1
    • TOM1-like protein 1
    • TOM1L1
    • TOM1L1 protein
    see all
  • Function
    Probable adapter protein involved in signaling pathways. Interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. May promotes FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
  • Sequence similarities
    Belongs to the TOM1 family.
    Contains 1 GAT domain.
    Contains 1 VHS domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosines by FYN (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Golgi apparatus > Golgi stack. Endosome membrane.
  • Information by UniProt

Images

  • ab153038 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up