Overview

  • Product nameRecombinant Human TOMM40 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKL TVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVG DMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFT A AVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVM SL AGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQD TSV SFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAF LNHR KNKFQCGFGLTIG
    • Amino acids55 to 361

Specifications

Our Abpromise guarantee covers the use of ab91997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 101 µl aqua dest.

General Info

  • Alternative names
    • C19orf1
    • D19S1177E
    • Haymaker protein
    • Mitochondrial import receptor subunit TOM40 homolog
    • Mitochondrial outer membrane protein
    • Mitochondrial outer membrane protein TOM40
    • p38.5
    • PER EC1
    • PEREC1
    • Probable mitochondrial import receptor subunit TOM40 homolog
    • Protein Haymaker
    • TOM40
    • TOM40_HUMAN
    • TOMM40
    • Translocase of outer membrane 40 kDa subunit homolog
    • Translocase of outer mitochondrial membrane 40
    • Translocase of outer mitochondrial membrane 40 homolog
    • Translocase of outer mitochondrial membrane 40 homolog (yeast)
    • Translocase of outer mitochondrial membrane 40, yeast, homolog of
    see all
  • FunctionChannel-forming protein essential for import of protein precursors into mitochondria.
  • Sequence similaritiesBelongs to the Tom40 family.
  • Cellular localizationMitochondrion outer membrane.
  • Information by UniProt

Recombinant Human TOMM40 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human TOMM40 protein (ab91997)

ab91997 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"