Recombinant Human Topoisomerase II beta protein (ab159736)

Overview

  • Product name
    Recombinant Human Topoisomerase II beta protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFD SNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKK VVEAVNSDSDSEF
    • Amino acids
      1411 to 1523
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen MLAA 44
    • beta isozyme
    • DNA topoisomerase 2 beta
    • DNA topoisomerase 2-beta
    • DNA topoisomerase II
    • DNA topoisomerase II 180 kD
    • DNA topoisomerase II beta
    • DNA topoisomerase II beta isozyme
    • Top 2
    • TOP 2B
    • TOP IIB
    • Top2 beta
    • TOP2B
    • TOP2B_HUMAN
    • Top2beta
    • TOPIIB
    • Topo II beta
    • Topoisomerase (DNA) II beta
    • Topoisomerase (DNA) II beta 180kDa
    • Topoisomerase IIb
    • U937 associated antigen
    see all
  • Function
    Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks. Indirectly ivolved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
  • Sequence similarities
    Belongs to the type II topoisomerase family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab159736 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up