Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCA RDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS
    • Amino acids
      298 to 397
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADIR
    • ADIR2
    • ATP dependant interferon response protein 1
    • ATP dependant interferon responsive
    • ATP dependent interferon responsive protein
    • ATP-dependent interferon-responsive protein
    • FLJ22345
    • MGC111104
    • Tor3a
    • TOR3A_HUMAN
    • torsin 3A
    • Torsin family 3 member A
    • torsin family 3, member A
    • Torsin-3A
    see all
  • Tissue specificity
    Ubiquitously expressed. Highest expression in stomach, salivary glands and lymph nodes. Isoform 2 is expressed in placenta.
  • Sequence similarities
    Belongs to the clpA/clpB family. Torsin subfamily.
  • Cellular localization
    Cytoplasm. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab163806 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up