Recombinant Human Torsin A protein (ab114565)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14656
    • SpeciesHuman
    • SequenceMKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECC GQKRSLSREALQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSL HGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPHASNITLYKDQ LQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNS GFWHSSLIHRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRV AEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
    • Molecular weight62 kDa including tags
    • Amino acids1 to 332

Specifications

Our Abpromise guarantee covers the use of ab114565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DQ2
    • Dystonia 1
    • Dystonia 1 protein
    • Dystonia 1 torsion
    • Dyt1
    • TOR1A
    • TOR1A_HUMAN
    • Torsin 1A
    • Torsin A
    • Torsin family 1 member A
    • Torsin family 1, member A (torsin A)
    • Torsin-1A
    see all
  • Information by UniProt

Recombinant Human Torsin A protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Torsin A protein (ab114565)

ab114565 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"