Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVG GTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
    • Molecular weight
      35 kDa including tags
    • Amino acids
      100 to 184

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D52
    • hD52
    • Human 19.8 kDa protein mRNA, complete cds
    • N8L
    • PC 1
    • PC1
    • PC1/MRPS28 fusion protein
    • PrLZ
    • Prostate and colon associated protein
    • Prostate leucine zipper
    • Protein N8
    • TPD52
    • TPD52_HUMAN
    • Tumor protein D52
    see all
  • Tissue specificity
    Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.
  • Sequence similarities
    Belongs to the TPD52 family.
  • Developmental stage
    Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152761 stained with Coomassie Blue.

References

ab152761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up