Recombinant human TPM3 + TRKA protein (ab191465)

Overview

  • Product name
    Recombinant human TPM3 + TRKA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Human
    • Sequence
      MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKK LKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEEL DRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLK EAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKN VTNNLKSLEAQAEKYMMEAIKKKMQ MLKLDKENAL DRAEQAEAEQ KQAEERSKQL EDELAAMQKK LKGTEDELDK YSEALKDAQE KLELAEKKAA DAEAEVASLN RRIQLVEEEL DRAQERLATA LQKLEEAEKA ADESERGMKV IENRALKDEE KMELQEIQLK EAKHIAEEAD RKYEEVARKL VIIEGDLERT EERAELAESK CSELEEELKN VTNNLKSLEA QAEKYSQKED KYEEEIKILT DKLKEAETRA EFAERSVAKL EKTIDDLE
    • Molecular weight
      105 kDa including tags
    • Amino acids
      1 to 258
    • Tags
      GST tag N-Terminus
    Amino Acid Sequence 2
    • Accession
    • Species
      Human
    • Sequence
      DTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKF GINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFS DACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKE ASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLN RFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVH RDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPES ILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELER PRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
    • Amino acids
      399 to 796

Specifications

Our Abpromise guarantee covers the use of ab191465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 12 nmol/min/mg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 70 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7
    Preservative: 1.02% Imidazole
    Constituents: 1.71% Sodium phosphate, 1.74% Sodium chloride, 0.001% PMSF, 0.004% DTT, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Gamma-tropomyosin
    • gp140trk
    • High affinity nerve growth factor receptor
    • hTM5
    • MTC
    • Neurotrophic tyrosine kinase receptor type 1
    • NTRK1
    • p140-TrkA
    • TPM3
    • TRK
    • Trk-A
    • TRK1-transforming tyrosine kinase protein
    • TRKA
    • Tropomyosin alpha-3 chain
    • Tropomyosin-3
    • Tropomyosin-5
    • Tyrosine kinase receptor
    • Tyrosine kinase receptor A
    see all
  • Relevance
    Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand, it can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival. Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation. Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors.
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein. Early endosome membrane; Single-pass type I membrane protein By similarity. Late endosome membrane; Single-pass type I membrane protein By similarity. Note: Internalized to endosomes upon binding of NGF or NTF3 and further transported to the cell body via a retrograde axonal transport. Localized at cell membrane and early endosomes before nerve growth factor (NGF) stimulation. Recruited to late endosomes after NGF stimulation. Colocalized with RAPGEF2 at late endosomes

Images

  • SDS-PAGE analysis of  ab191465

  • Specific Activity: Sample Kinase Activity Plot. The specific activity of ab191465 was determined to be 12 nmol /min/mg as per activity assay protocol.

References

ab191465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up