Overview

  • Product name
    Recombinant Human TPPC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVS KMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHI YSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
    • Amino acids
      1 to 145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BET5
    • BET5 homolog
    • Melanoma ubiquitous mutated 2
    • Multiple myeloma protein 2
    • MUM 2
    • MUM-2
    • MUM2
    • TPPC1_HUMAN
    • Trafficking protein particle complex 1
    • Trafficking protein particle complex subunit 1
    • TRAPPC 1
    • Trappc1
    see all
  • Function
    May play a role in vesicular transport from endoplasmic reticulum to Golgi.
  • Sequence similarities
    Belongs to the TRAPP small subunits family. BET5 subfamily.
  • Cellular localization
    Golgi apparatus > cis-Golgi network. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab163674 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up