Overview

  • Product name
    Recombinant Human TPTE protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTS FIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD
    • Amino acids
      434 to 533
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 44
    • CT44
    • EC=3.1.3.48
    • HGNC:12023
    • PTEN2
    • Putative tyrosine protein phosphatase
    • Putative tyrosine-protein phosphatase TPTE
    • TPTE
    • TPTE_HUMAN
    • Transmembrane phosphatase with tensin homology
    • Tumor antigen BJ HCC 5
    • Tumor antigen BJ-HCC-5
    see all
  • Function
    Could be involved in signal transduction.
  • Tissue specificity
    Exclusively expressed in testis.
  • Sequence similarities
    Contains 1 C2 tensin-type domain.
    Contains 1 phosphatase tensin-type domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159743 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up