Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENV DDAKEAKERANGMELDGRRIRVDFSITKRP
    • Molecular weight
      34 kDa including tags
    • Amino acids
      120 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114393 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris citrate/phosphate, 0.3% Glutathione

General Info

  • Alternative names
    • arginine/serine-rich 10
    • Arginine/serine-rich splicing factor 10
    • hTRA2-beta
    • SFRS10
    • Splicing factor
    • Splicing factor arginine/serine rich 10
    • SRFS10
    • TRA-2 beta
    • TRA2-beta
    • Tra2b
    • TRA2B_HUMAN
    • TRAN2B
    • Transformer 2 beta homolog
    • Transformer-2 protein homolog B
    • Transformer-2 protein homolog beta
    • Transformer-2-beta
    see all
  • Function
    Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
  • Tissue specificity
    Highest expression in heart, skeletal muscle and pancreas. Less abundant in kidney, placenta and brain. Lowest expression in kidney and liver.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated in the RS domains.
    Dimethylation at Arg-241 is probably asymmetric.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114393 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up