Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP62995
    • SpeciesHuman
    • SequenceLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENV DDAKEAKERANGMELDGRRIRVDFSITKRP
    • Molecular weight34 kDa including tags
    • Amino acids120 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114393 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris citrate/phosphate, 0.3% Glutathione

General Info

  • Alternative names
    • arginine/serine-rich 10
    • Arginine/serine-rich splicing factor 10
    • hTRA2-beta
    • SFRS10
    • Splicing factor
    • Splicing factor arginine/serine rich 10
    • SRFS10
    • TRA-2 beta
    • TRA2-beta
    • Tra2b
    • TRA2B_HUMAN
    • TRAN2B
    • Transformer 2 beta homolog
    • Transformer-2 protein homolog B
    • Transformer-2 protein homolog beta
    • Transformer-2-beta
    see all
  • FunctionSequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
  • Tissue specificityHighest expression in heart, skeletal muscle and pancreas. Less abundant in kidney, placenta and brain. Lowest expression in kidney and liver.
  • Sequence similaritiesBelongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated in the RS domains.
    Dimethylation at Arg-241 is probably asymmetric.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TRA2B protein images

  • ab114393 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human TRA2B protein (ab114393)

ab114393 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"