Recombinant Human TRAF6 protein (ab132023)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSLLNCENSCGFSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFM EEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRD AGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLED HQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFED KEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCN GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTA QRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIM DAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVS TRFDMGSLRREGFQPRSTDAGV
    • Molecular weight
      86 kDa
    • Amino acids
      1 to 522
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase TRAF6
    • Interleukin 1 signal transducer
    • Interleukin-1 signal transducer
    • MGC 3310
    • MGC:3310
    • MGC3310
    • OTTHUMP00000232772
    • OTTHUMP00000232773
    • RING finger protein 85
    • RNF 85
    • RNF85
    • TNF receptor associated factor 6
    • TNF receptor-associated factor 6
    • TNF receptor-associated factor 6, E3 ubiquitin protein ligase
    • TRAF 6
    • Traf6
    • TRAF6_HUMAN
    see all
  • Function
    E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c-Myb-mediated transactivation, in B lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor.
  • Tissue specificity
    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TNF receptor-associated factor family. A subfamily.
    Contains 1 MATH domain.
    Contains 1 RING-type zinc finger.
    Contains 2 TRAF-type zinc fingers.
  • Domain
    The coiled coil domain mediates homo- and hetero-oligomerization.
    The MATH/TRAF domain binds to receptor cytoplasmic domains.
  • Post-translational
    modifications
    Sumoylated on Lys-124, Lys-142 and Lys-453 by SUMO1.
    Polyubiquitinated on Lys-124; after cell stimulation with IL-1-beta or TGF-beta. This ligand-induced cell stimulation leads to dimerization/oligomerization of TRAF6 molecules, followed by auto-ubiquitination which involves UBE2N and UBE2V1 and leads to TRAF6 activation. This 'Lys-63' site-specific poly-ubiquitination appears to be associated with the activation of signaling molecules. Endogenous autoubiquitination occurs only for the cytoplasmic form.
  • Cellular localization
    Cytoplasm. Cytoplasm > cell cortex. Nucleus. Found in the nuclei of some agressive B-cell lymphoma cell lines as well as in the nuclei of both resting and activated T-and B-lymphocytes. Found in punctate nuclear body protein complexes. Ubiquitination may occur in the cytoplasm and sumoylation in the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132023 at approximately 86 kDa.

References

ab132023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

We have not tested the recombinant TRAF6 ab132023 in an activity assay. It may have activity but the only we have data are from the immunoassays listed on the datasheet, ELISA and western blotting. The expression system was wheat germ. The web page at ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up