Recombinant Human TRAF6BP protein (ab152936)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPP NYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
    • Amino acids
      690 to 789
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200003J11Rik
    • 1700069J21Rik
    • Aa1076
    • AA930106
    • CALCOCO 3
    • CALCOCO3
    • D6Ertd404e
    • D6Ertd772e
    • Human T cell leukemia virus type 1-binding protein
    • Liver regeneration-related protein LRRG004
    • MGC94031
    • PRO0105
    • T6BP
    • Tax1 (human T cell leukemia virus type I) binding protein
    • Tax1 (human T cell leukemia virus type I) binding protein 1
    • Tax1 binding protein
    • Tax1 binding protein 1
    • Tax1-binding protein 1
    • Tax1-binding protein 1 homolog
    • TAX1BP1
    • TAX1BP1 protein
    • tax1bp1b
    • TAXB1_HUMAN
    • TRAF 6 binding protein
    • TRAF6 binding protein
    • TRAF6 binding protein T6BP
    • TRAF6-binding protein
    • TRAF6-interacting protein
    • TXBP 151
    • TXBP151
    • wu:fc20c12
    • wu:fc56e11
    • zgc:73219
    • zgc:77129
    see all
  • Function
    Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade.
  • Tissue specificity
    Expressed in all tissues tested.
  • Information by UniProt

Images

  • ab152936 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up