Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VFKDPVITTCGHTFCRRCALKSEKCPVDNVKLTVVVNNIAVAEQIGELFI HCRHGCRVAGSGKPPIFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCPNN
    • Amino acids
      61 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase TRAF7
    • E3 ubiquitin-protein ligase TRAF7
    • RFWD1
    • Ring finger and WD repeat domain 1
    • RING finger and WD repeat-containing protein 1
    • RING finger protein 119
    • RNF119
    • TNF receptor associated factor 7
    • TNF receptor-associated factor 7
    • TRAF7
    • TRAF7_HUMAN
    see all
  • Function
    E3 ubiquitin ligase capable of auto-ubiquitination, following phosphorylation by MAP3K3. Potentiates MEKK3-mediated activation of the NF-kappa-B, JUN/AP1 and DDIT3 transcriptional regulators. Induces apoptosis when overexpressed.
  • Tissue specificity
    Ubiquitously expressed with high levels in skeletal muscle, heart, colon, spleen, kidney, liver and placenta.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the WD repeat TRAF7 family.
    Contains 1 RING-type zinc finger.
    Contains 1 TRAF-type zinc finger.
    Contains 7 WD repeats.
  • Post-translational
    modifications
    Phosphorylated by MAP3K3.
    Ubiquitinates itself upon phosphorylation.
  • Cellular localization
    Cytoplasmic vesicle. Colocalizes with MAP3K3 to vesicle-like structures throughout the cytoplasm.
  • Information by UniProt

Images

  • ab164531 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up