Recombinant human TRAIL protein (ab109360)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYF RFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLY SIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
    • Molecular weight
      23 kDa including tags
    • Amino acids
      95 to 281
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Induces apoptosis of Human Jurkat T cells in a concentration range of 5-50ng/ml in the presence of 1µg/ml TNF Ligands Enhancer. In the absence of TNF Ligands Enhancer, ab109360 is poorly active.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names
    • Apo 2 ligand
    • APO 2L
    • Apo-2 ligand
    • Apo-2L
    • APO2L
    • CD253
    • CD253 antigen
    • Chemokine tumor necrosis factor ligand superfamily member 10
    • Protein TRAIL
    • TL2
    • TNF Related Apoptosis Inducing Ligand
    • TNF related apoptosis inducing ligand TRAIL
    • TNF-related apoptosis-inducing ligand
    • TNF10_HUMAN
    • TNFSF10
    • TRAIL
    • Tumor necrosis factor (ligand) family member 10
    • Tumor Necrosis Factor (ligand) Superfamily Member 10
    • Tumor necrosis factor apoptosis inducing ligand splice variant delta
    • Tumor necrosis factor ligand superfamily member 10
    see all
  • Function
    Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
  • Tissue specificity
    Widespread; most predominant in spleen, lung and prostate.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab109360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.
I have attached the data for the Functional Studies done with ab2219. We will add these to the datasheet as well very soon.
Also, I wanted to send you the information about our 3 for 2 promotion for all proteins t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up