Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
    • Molecular weight
      22 kDa
    • Amino acids
      95 to 281
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Induces apoptosis in a concentration range of 10-100ng/ml. Does not require a cross-linking enhancer for its potent biological activity. ED50: 20 ng/ml (BJAB cells).
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    <=0.040 Eu/µg
  • Purity
    >= 99 % SDS-PAGE.
    ab168898 is affinity purified and sterile filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 0.02% DTT, 0.01% Tween, 0.48% HEPES, 1% Sucrose, 1.75% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Apo 2 ligand
    • APO 2L
    • Apo-2 ligand
    • Apo-2L
    • APO2L
    • CD253
    • CD253 antigen
    • Chemokine tumor necrosis factor ligand superfamily member 10
    • Protein TRAIL
    • TL2
    • TNF Related Apoptosis Inducing Ligand
    • TNF related apoptosis inducing ligand TRAIL
    • TNF-related apoptosis-inducing ligand
    • TNF10_HUMAN
    • TNFSF10
    • TRAIL
    • Tumor necrosis factor (ligand) family member 10
    • Tumor Necrosis Factor (ligand) Superfamily Member 10
    • Tumor necrosis factor apoptosis inducing ligand splice variant delta
    • Tumor necrosis factor ligand superfamily member 10
    see all
  • Function
    Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
  • Tissue specificity
    Widespread; most predominant in spleen, lung and prostate.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Apoptosis of TRAIL-sensitive cells. Concentration dependence of apoptosis induction in Jurkat and BJAB cells by ab168898 reveals high activity even at concentrations of 10-100 ng/ml.
  • Specificity of ab168898-induced apoptosis. Concentration dependent blocking of apoptosis induction of BJAB cells using MAb to Human TRAIL reveals specificity of ab168898-mediated killing.
  • Apoptosis of TRAIL-sensitive myeloid cell line ML-1.
  • Flow cytometry analysis of the TRAIL-sensitive human leukemia cell line HL60 and of TRAIL-resistant K572 cells using ab168898.

References

ab168898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up