Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFI LPQYNISVPTADSETVHYHYGPKDLVTILFYIFITIILHAVVQEYILDKI SKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGYLTNPRSLWED YPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLV HIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFADENNEKLFSAWAA VFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHE NGVVKAENGTSPRTKKLKSP
    • Amino acids
      1 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C330003D03Rik
    • KIAA0057
    • MGC25725
    • OTTHUMP00000016607
    • TRAM like protein
    • Tram2
    • TRAM2_HUMAN
    • Translocating chain associating membrane protein 2
    • Translocating chain-associated membrane protein 2
    • Translocation associated membrane protein 2
    see all
  • Function
    Necessary for collagen type I synthesis. May couple the activity of the ER Ca(2+) pump SERCA2B with the activity of the translocon. This coupling may increase the local Ca(2+) concentration at the site of collagen synthesis, and a high Ca(2+) concentration may be necessary for the function of molecular chaperones involved in collagen folding.
  • Sequence similarities
    Belongs to the TRAM family.
    Contains 1 TLC (TRAM/LAG1/CLN8) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160614 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up