Recombinant Human Transaldolase 1 protein (ab99243)

Overview

  • Product nameRecombinant Human Transaldolase 1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP37837
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSSPVKRQRMESALDQLKQFTTVVADTGD FHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQI KNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYK EAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYK TIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQ ASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERM FNAENGK
    • Molecular weight40 kDa including tags
    • Amino acids1 to 337
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99243 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Dihydroxyacetone transferase
    • EC 2.2.1.2
    • EPS8L2
    • Glycerone transferase
    • TAL
    • TAL H
    • TALDO
    • TALDO_HUMAN
    • TALDO1
    • TALDOR
    • TALH
    • Transaldolase
    • Transaldolase 1
    see all
  • FunctionTransaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
  • PathwayCarbohydrate degradation; pentose phosphate pathway; D-glyceraldehyde 3-phosphate and beta-D-fructose 6-phosphate from D-ribose 5-phosphate and D-xylulose 5-phosphate (non-oxidative stage): step 2/3.
  • Involvement in diseaseDefects in TALDO1 are the cause of transaldolase 1 deficiency (TALDO1 deficiency) [MIM:606003]. It results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris.
  • Sequence similaritiesBelongs to the transaldolase family. Type 1 subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Transaldolase 1 protein images

  • 15% SDS-PAGE showing ab99243 at approximately 39.7kDa (3µg).

References for Recombinant Human Transaldolase 1 protein (ab99243)

ab99243 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"