Recombinant Human Transcription factor 25 protein (ab161488)

Overview

  • Product name
    Recombinant Human Transcription factor 25 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELGVRRPGG AGKEGVRVNNRFELINIDDLEDDPVVNGERSGCALTDAVAPGNKGRGQRG NTESKTDGDDTETVPSEQSHASGKLRKKKKKQKNKKSSTGEASENGLEDI DRILERIEDSTGLNRPGPAPLSSRKHVLYVEHRHLNPDTELKRYFGARAI LGEQRPRQRQRVYPKCTWLTTPKSTWPRYSKPGLSMRLLESKKGLSFFAF EHSEEYQQAQHKFLVAVESMEPNNIVVLLQTSPYHVDSLLQLSDACRFQE DQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQ MSFLEKRGCPRTALEYCKLILSLEPDEDPLCMLLLIDHLALRARNYEYLI RLFQEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLL IQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQPPALSQLVN LYLGRSHFLWKEPATMSWLEENVHEVLQAVDAGDPAVEACENRRKVLYQR APRNIHRHVILSEIKEAVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPER LSPISHGNTIALFFRSLLPNYTMEGERPEEGVAGGLNRNQGLNRLMLAVR DMMANFHLNDLEAPHEDDAEGEGEWD
    • Amino acids
      1 to 676
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FKSG26
    • hKIAA1049
    • Hulp1
    • KIAA1049
    • Nuclear localized protein 1
    • NULP1
    • PRO2620
    • TCF-25
    • Tcf25
    • TCF25_HUMAN
    • Transcription factor 25
    • Transcription factor 25 (basic helix loop helix)
    see all
  • Function
    May play a role in cell death control. Acts as a transcriptional repressor. Has been shown to repress transcription of SRF in vitro and so may play a role in heart development.
  • Tissue specificity
    In the embryo, widely expressed with highest levels in brain. In the adult, highest expression is found in the heart.
  • Sequence similarities
    Belongs to the TCF25 family.
  • Domain
    The C-terminal region mediates transcriptional repression.
  • Cellular localization
    Nucleus. Some staining in the cytosol.
  • Information by UniProt

Images

  • ab161488 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up