Recombinant Human Transcription factor Sp4 protein (ab116910)

Overview

  • Product name
    Recombinant Human Transcription factor Sp4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TKTKSGNSSTPGQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQINPTSSS SLQDLQGQIKLISAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGV SIPLQLQTLP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      138 to 247

Specifications

Our Abpromise guarantee covers the use of ab116910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HF1B
    • MGC130008
    • MGC130009
    • Sp4
    • SP4_HUMAN
    • SPR-1
    • SPR1
    • Transcription factor Sp4
    see all
  • Function
    Binds to GT and GC boxes promoters elements. Probable transcriptional activator.
  • Tissue specificity
    Abundant in brain.
  • Sequence similarities
    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116910 at approximately 37.73 kDa.

References

ab116910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up