Recombinant Human Transcription termination factor 1 protein (ab159754)

Overview

  • Product name
    Recombinant Human Transcription termination factor 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQIT RRKKRKKDFQHLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEE
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • RNA polymerase I termination factor
    • Transcription termination factor 1
    • Transcription termination factor I
    • Transcription termination factor RNA polymerase I
    • TTF 1
    • TTF-1
    • TTF-I
    • Ttf1
    • TTF1_HUMAN
    see all
  • Function
    Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation and silencing of rDNA transcription. Interaction with BAZ2A/TIP5 recovers DNA-binding activity.
  • Sequence similarities
    Contains 2 Myb-like domains.
  • Domain
    The N-terminal region (NRD) inhibits DNA-binding via its interaction with the C-terminal region.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab159754 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up