Recombinant Human Transferrin protein (ab155698)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIR AIAANEADAV TLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAV AVVKKDSGFQMNQLRGKKSCHT GLGRSAGWNIPIGLLYCDLPEPRKPL EKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCS TLNQYFGYSGAFKC LKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKD CH LAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKD LLFKDSAH GFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECK PVKWCALSHHERLKCDEWSV NSVGKIECVSAETTEDCIAKIMNGEADA MSLDGGFVYIAGKCGLVPVLAENYNKSDNCED TPEAGYFAIAVVKKSA SDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFF SEGC APGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVK HQTVPQ NTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARA PNHAVVTRKDKEACVHKI LRQQQHLFGSNVTDCSGNFCLFRSETKDLL FRDDTVCLAKLHDRNTYEKYLGEEYVKAVG NLRKCSTSSLLEACTFRR P
    • Molecular weight
      76 kDa
    • Amino acids
      20 to 698
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names
    • Apotransferrin
    • Beta 1 metal binding globulin
    • Beta-1 metal-binding globulin
    • DKFZp781D0156
    • PRO1400
    • PRO1557
    • PRO2086
    • Serotransferrin
    • Serotransferrin precursor
    • Siderophilin
    • TF
    • TFQTL1
    • Transferin
    • Transferrin
    • TRFE_HUMAN
    see all
  • Function
    Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Involvement in disease
    Defects in TF are the cause of atransferrinemia (ATRAF) [MIM:209300]. Atransferrinemia is rare autosomal recessive disorder characterized by iron overload and hypochromic anemia.
  • Sequence similarities
    Belongs to the transferrin family.
    Contains 2 transferrin-like domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab155698 stained overnight with Coomassie Blue.

References

ab155698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up