Recombinant Human Transferrin Receptor protein (ab159687)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFP AARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLAL Y
    • Amino acids
      68 to 168
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 71
    • CD71
    • CD71 antigen
    • IMD46
    • OTTHUMP00000208523
    • OTTHUMP00000208524
    • OTTHUMP00000208525
    • p90
    • sTfR
    • T9
    • TfR
    • TFR 1
    • TfR1
    • TFR1_HUMAN
    • TFRC
    • TR
    • Transferrin receptor (p90 CD71)
    • Transferrin receptor protein 1, serum form
    • Trfr
    see all
  • Function
    Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake (PubMed:26642240).
    (Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus.
  • Involvement in disease
    Immunodeficiency 46
  • Sequence similarities
    Belongs to the peptidase M28 family. M28B subfamily.
    Contains 1 PA (protease associated) domain.
  • Post-translational
    modifications
    N- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.
    Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).
    Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation.
  • Cellular localization
    Secreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab159687 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up