Recombinant Human Transglutaminase 2 protein (ab152749)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY EASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTL SLQLTTPANAPIGLYRLSLE
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 120

Specifications

Our Abpromise guarantee covers the use of ab152749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALPHA SUBUNIT
    • C polypeptide
    • EC 2.3.2.13
    • epididymis secretory protein Li 45
    • G alpha h
    • G[a]h
    • Gh CLASS G ALPHA h
    • GNAH
    • GNAH G PROTEIN
    • H POLYPEPTIDE
    • HEL-S-45
    • Protein glutamine gamma glutamyltransferase 2
    • Protein-glutamine gamma-glutamyltransferase 2
    • TG 2
    • TG(C)
    • TG2
    • TGase C
    • TGase H
    • TGase-2
    • TgaseII
    • TGC
    • TGC GUANINE NUCLEOTIDE BINDING PROTEIN
    • TGM2
    • TGM2_HUMAN
    • Tissue transglutaminase
    • Transglutaminase 2
    • Transglutaminase 2 C polypeptide
    • Transglutaminase C
    • Transglutaminase H
    • Transglutaminase-2
    • tTG
    • tTGas
    see all
  • Function
    Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
  • Sequence similarities
    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152749 stained with Coomassie Blue.

References

ab152749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up