Recombinant Human Transition Protein 1 (ab152757)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN YRSHL
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 55

Specifications

Our Abpromise guarantee covers the use of ab152757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Spermatid nuclear transition protein 1
    • Spermatid nuclear transition protein1
    • STP 1
    • STP-1
    • STP1
    • STP1_HUMAN
    • TNP 1
    • TNP1
    • TP 1
    • TP-1
    • TP1
    • Transition protein 1 (during histone to protamine replacement)
    • Transition protein1
    see all
  • Function
    In the elongating spermatids of mammals, the conversion of nucleosomal chromatin to the compact, non-nucleosomal form found in the sperm nucleus is associated with the appearance of a small set of basic chromosomal transition proteins.
  • Tissue specificity
    Testis.
  • Sequence similarities
    Belongs to the nuclear transition protein 1 family.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152757 stained with Coomassie Blue.

References

ab152757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up