Recombinant Human Translin protein (ab99862)

Overview

  • Product name
    Recombinant Human Translin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAG FQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVF LAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE LSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKY DVKKVEEVVYDLSIRGFNKETAAACVEK
    • Molecular weight
      26 kDa
    • Amino acids
      1 to 228

Associated products

Specifications

Our Abpromise guarantee covers the use of ab99862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99862 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BCLF 1
    • BCLF1
    • Component 3 of promoter of RISC
    • RCHF1
    • recombination hotspot associated factor
    • recombination hotspot binding protein
    • rehf 1
    • REHF1
    • TBRBP
    • Translin
    • TRSLN
    • TSN
    • TSN_HUMAN
    see all
  • Information by UniProt

Recombinant Human Translin protein images

  • 15% SDS-PAGE showing ab99862 (3µg).

References for Recombinant Human Translin protein (ab99862)

ab99862 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up