Recombinant Human Translin protein (ab99862)

Overview

  • Product name
    Recombinant Human Translin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAG FQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVF LAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE LSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKY DVKKVEEVVYDLSIRGFNKETAAACVEK
    • Molecular weight
      26 kDa
    • Amino acids
      1 to 228

Associated products

Specifications

Our Abpromise guarantee covers the use of ab99862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99862 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BCLF 1
    • BCLF1
    • Component 3 of promoter of RISC
    • RCHF1
    • recombination hotspot associated factor
    • recombination hotspot binding protein
    • rehf 1
    • REHF1
    • TBRBP
    • Translin
    • TRSLN
    • TSN
    • TSN_HUMAN
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99862 (3µg).

References

ab99862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up