Recombinant Human Transportin 1 protein (ab114514)

Overview

  • Product nameRecombinant Human Transportin 1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92973-2
    • SpeciesHuman
    • SequencePDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKN NVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQ NWPDLLPKLCSLLDSED*
    • Molecular weight39 kDa including tags
    • Amino acids25 to 141

Specifications

Our Abpromise guarantee covers the use of ab114514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Importin 2
    • Importin beta 2
    • Importin beta-2
    • IPO 2
    • IPO2
    • Karyopherin (importin) beta 2
    • Karyopherin beta 2
    • Karyopherin beta-2
    • KPN B2
    • KPNB 2
    • KPNB2
    • M9 interacting protein
    • M9 region interacting protein
    • M9 region interaction protein
    • MIP
    • MIP 1
    • MIP1
    • OTTHUMP00000126960
    • OTTHUMP00000222024
    • OTTHUMP00000226224
    • TNPO 1
    • Tnpo1
    • TNPO1_HUMAN
    • Transportin
    • Transportin 1
    • Transportin-1
    • Transportin1
    • TRN
    see all
  • FunctionFunctions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Appears also to be involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones, and SRP19. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.
  • Sequence similaritiesBelongs to the importin beta family.
    Contains 8 HEAT repeats.
    Contains 1 importin N-terminal domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Transportin 1 protein images

  • ab114514 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Transportin 1 protein (ab114514)

ab114514 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"