Recombinant Human TRAP alpha protein (ab114760)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43307
    • SpeciesHuman
    • SequenceQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPS ADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQF YIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNG NVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESR KRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSV GSDE
    • Molecular weight54 kDa including tags
    • Amino acids33 to 286

Specifications

Our Abpromise guarantee covers the use of ab114760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781N23103
    • FLJ14232
    • FLJ22100
    • FLJ23034
    • FLJ78242
    • FLJ93042
    • PGP35
    • Signal sequence receptor alpha
    • Signal sequence receptor alpha subunit
    • Signal sequence receptor subunit alpha
    • SSR 1
    • SSR alpha
    • SSR-alpha
    • SSR1
    • SSRA_HUMAN
    • SSRalpha
    • Translocon associated protein alpha
    • Translocon associated protein alpha subunit
    • Translocon associated protein subunit alpha
    • Translocon-associated protein subunit alpha
    • TRAP a
    • TRAP-alpha
    • TRAPa
    • TRAPalpha
    see all
  • FunctionTRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.
  • Sequence similaritiesBelongs to the TRAP-alpha family.
  • DomainShows a remarkable charge distribution with the N-terminus being highly negatively charged, and the cytoplasmic C-terminus positively charged.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human TRAP alpha protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114760 at approximately 54.05kDa.

References for Recombinant Human TRAP alpha protein (ab114760)

ab114760 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"