Recombinant Human TRAP alpha protein (ab114760)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPS ADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQF YIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNG NVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESR KRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSV GSDE
    • Molecular weight
      54 kDa including tags
    • Amino acids
      33 to 286

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781N23103
    • FLJ14232
    • FLJ22100
    • FLJ23034
    • FLJ78242
    • FLJ93042
    • PGP35
    • Signal sequence receptor alpha
    • Signal sequence receptor alpha subunit
    • Signal sequence receptor subunit alpha
    • SSR 1
    • SSR alpha
    • SSR-alpha
    • SSR1
    • SSRA_HUMAN
    • SSRalpha
    • Translocon associated protein alpha
    • Translocon associated protein alpha subunit
    • Translocon associated protein subunit alpha
    • Translocon-associated protein subunit alpha
    • TRAP a
    • TRAP-alpha
    • TRAPa
    • TRAPalpha
    see all
  • Function
    TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.
  • Sequence similarities
    Belongs to the TRAP-alpha family.
  • Domain
    Shows a remarkable charge distribution with the N-terminus being highly negatively charged, and the cytoplasmic C-terminus positively charged.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114760 at approximately 54.05kDa.

References

ab114760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up