Recombinant Human TRAP220/MED1 protein (ab159163)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human TRAP220/MED1 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGST PKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP -
Amino acids
1391 to 1490 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159163 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Activator-recruited cofactor 205 kDa component
- ARC205
- CRSP1
see all -
Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. -
Tissue specificity
Ubiquitously expressed. -
Sequence similarities
Belongs to the Mediator complex subunit 1 family. -
Post-translational
modificationsPhosphorylated by MAPK1 or MAPK3 during G2/M phase which may enhance protein stability and promote entry into the nucleolus. Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. A subset of the protein may enter the nucleolus subsequent to phosphorylation by MAPK1 or MAPK3. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab159163 has not yet been referenced specifically in any publications.