Recombinant Human TRAP220/MED1 protein (ab159163)

Overview

  • Product name
    Recombinant Human TRAP220/MED1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGST PKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
    • Amino acids
      1391 to 1490
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator-recruited cofactor 205 kDa component
    • ARC205
    • CRSP1
    • CRSP200
    • DRIP205
    • DRIP230
    • MED1
    • MED1_HUMAN
    • Mediator complex subunit 1
    • Mediator of RNA polymerase II transcription subunit 1
    • p53 regulatory protein RB18A
    • PBP
    • Peroxisome proliferator-activated receptor-binding protein
    • PPAR binding protein
    • PPAR-binding protein
    • PPARBP
    • PPARGBP
    • RB18A
    • Thyroid hormone receptor-associated protein complex 220 kDa component
    • Thyroid receptor-interacting protein 2
    • TR-interacting protein 2
    • Trap220
    • TRIP-2
    • TRIP2
    • Vitamin D receptor-interacting protein complex component DRIP205
    see all
  • Function
    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the Mediator complex subunit 1 family.
  • Post-translational
    modifications
    Phosphorylated by MAPK1 or MAPK3 during G2/M phase which may enhance protein stability and promote entry into the nucleolus. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. A subset of the protein may enter the nucleolus subsequent to phosphorylation by MAPK1 or MAPK3.
  • Information by UniProt

Images

  • ab159163 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up