Recombinant Human TRAPPC9 protein (ab164427)

Overview

  • Product name
    Recombinant Human TRAPPC9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLP AEAANRHRPGALTTNGINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSK YKNAGVIELEACIKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQ RYSILSELYELIGFHRKSAFFKRVAAMQCVAPSIAEPGWRACYKLLLETL PGYSLSLDPKDFSRGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF LLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTK LPIVRHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAHNRGEERN KKIDFQWVQGDVCEVQLMVYNPMPFELRVENMGLLTSGVEFESLPAALSL PAESGLYPVTLVGVPQTTGTITVNGYHTTVFGVFSDCLLDNLPGIKTSGS TVEVIPALPRLQISTSLPRSAHSLQPSSGDEISTNVSVQLYNGESQQLII KLENIGMEPLEKLEVTSKVLTTKEKLYGDFLSWKLEETLAQFPLQPGKVA TFTINIKVKLDFSCQENLLQDLSDDGISVSGFPLSSPFRQVVRPRVEGKP VNPPESNKAGDYSHVKTLEAVLNFKYSGGPGHTEGYYRNLSLGLHVEVEP SVFFTRVSTLPATSTRQCHLLLDVFNSTEHELTVSTRSSEALILHAGECQ RMAIQVDKFNFESFPESPGEKGQFANPKQLEEERREARGLEIHSKLGICW RIPSLKRSGEASVEGLLNQLVLEHLQLAPLQWDVLVDGQPCDREAVAACQ VGDPVRLEVRLTNRSPRSVGPFALTVVPFQDHQNGVHNYDLHDTVSFVGS STFYLDAVQPSGQSACLGALLFLYTGDFFLHIRFHEDSTSKELPPSWFCL PSVHVCALEAQA
    • Amino acids
      1 to 912
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810044A24Rik
    • 2900005P22Rik
    • 4632408O18Rik
    • Ibp
    • IKBKBBP
    • Ikk2 binding protein
    • KIAA1882
    • MGC4737
    • MGC4769
    • mKIAA1882
    • MRT13
    • Nibp
    • NIK and IKK(beta) binding protein
    • NIK and IKK{beta} binding protein
    • RGD1309461
    • T1
    • Trafficking protein particle complex 9
    • TRAPP 120 kDa subunit
    • TRS130
    • Tularik gene 1 protein
    see all
  • Relevance
    TRAPPC9 functions as an activator of NF-kappa-B through increased phosphorylation of the IKK complex. It may also function in neuronal cells differentiation and play a role in vesicular transport from endoplasmic reticulum to Golgi.
  • Cellular localization
    Golgi apparatus; cis-Golgi network. Endoplasmic reticulum. Cytoplasm. Note: Processes and cell bodies of neurons.

Images

  • ab164427 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up