Recombinant Human Treacher Collins syndrome protein (ab114719)

Overview

  • Product name
    Recombinant Human Treacher Collins syndrome protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYT HWQQTSELGRKRKAEEDAALQAKKTRVSDPI
    • Molecular weight
      35 kDa including tags
    • Amino acids
      2 to 82

Specifications

Our Abpromise guarantee covers the use of ab114719 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mandibulofacial dysostosis
    • MFD1
    • Nucleolar trafficking phosphoprotein
    • TCOF 1
    • TCOF_HUMAN
    • TCOF1
    • TCS
    • TCS1
    • Treacher Collins Franceschetti syndrome 1
    • Treacher Collins syndrome
    • Treacher Collins syndrome protein
    • Treacle
    • Treacle protein
    see all
  • Function
    May be involved in nucleolar-cytoplasmic transport. May play a fundamental role in early embryonic development, particularly in development of the craniofacial complex.
  • Involvement in disease
    Defects in TCOF1 are the cause of Treacher Collins syndrome type 1 (TCS1) [MIM:154500]. It is a form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss.
  • Sequence similarities
    Contains 1 LisH domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114719 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114719.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up