Recombinant Human Treacher Collins syndrome protein (ab114719)

Overview

  • Product name
    Recombinant Human Treacher Collins syndrome protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYT HWQQTSELGRKRKAEEDAALQAKKTRVSDPI
    • Molecular weight
      35 kDa including tags
    • Amino acids
      2 to 82

Specifications

Our Abpromise guarantee covers the use of ab114719 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mandibulofacial dysostosis
    • MFD1
    • Nucleolar trafficking phosphoprotein
    • TCOF 1
    • TCOF_HUMAN
    • TCOF1
    • TCS
    • TCS1
    • Treacher Collins Franceschetti syndrome 1
    • Treacher Collins syndrome
    • Treacher Collins syndrome protein
    • Treacle
    • Treacle protein
    see all
  • Function
    May be involved in nucleolar-cytoplasmic transport. May play a fundamental role in early embryonic development, particularly in development of the craniofacial complex.
  • Involvement in disease
    Defects in TCOF1 are the cause of Treacher Collins syndrome type 1 (TCS1) [MIM:154500]. It is a form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss.
  • Sequence similarities
    Contains 1 LisH domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Recombinant Human Treacher Collins syndrome protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Treacher Collins syndrome protein (ab114719)

ab114719 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114719.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up