Recombinant Human Trefoil Factor 3 protein (ab117676)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDS RIPGVPWCFKPLQEAECTF
    • Molecular weight
      8 kDa including tags
    • Amino acids
      22 to 80
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab117676 is purified by proprietary chromatographic techniques and 0.4µm filtered.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized ab117676 is stable at room temperature for 3 weeks, but should be stored desiccated below -18°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.50
    Constituents: 0.24% Tris, 0.88% Sodium chloride

  • Reconstitution
    Add deionized water to a working concentration approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by appropriate sterile filter before using it in the cell culture. Upon reconstitution ab117676 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

General Info

  • Alternative names
    • hITF
    • hP1.B
    • Intestinal trefoil factor
    • ITF
    • mITF
    • OTTMUSP00000021729
    • P1B
    • Polypeptide P1.B
    • TFF3
    • TFF3_HUMAN
    • TFI
    • TREFOIL
    • Trefoil factor (intestinal)
    • Trefoil factor 3
    see all
  • Function
    Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
  • Tissue specificity
    Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus.
  • Sequence similarities
    Contains 1 P-type (trefoil) domain.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > apical lamina.
  • Information by UniProt

References

ab117676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up