Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BQ50
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAEL SLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEIT GL SSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPL LCAE LRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGS LFHRYF RAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHI EPMYLPPD DPSLEA
    • Molecular weight28 kDa including tags
    • Amino acids1 to 236
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 3' 5' exonuclease
    • 3' 5' exonuclease TREX2
    • 3'-5' exonuclease TREX2
    • Three prime repair exonuclease 2
    • TREX 2
    • TREX2
    • TREX2_HUMAN
    see all
  • FunctionExonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.
  • Tissue specificityDetected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
  • Sequence similaritiesBelongs to the exonuclease superfamily. TREX family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TREX2 protein images

  • 15% SDS-PAGE showing ab104641 at approximately 28kDa (3µg).

References for Recombinant Human TREX2 protein (ab104641)

ab104641 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"