Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BQ50-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAEL SLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGL SSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAE LRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYF RAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPD DPSLEA
    • Molecular weight28 kDa including tags
    • Amino acids1 to 236
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab124849 is purified by proprietary chromatographic techniques and sterile filtered.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 3' 5' exonuclease
    • 3' 5' exonuclease TREX2
    • 3'-5' exonuclease TREX2
    • Three prime repair exonuclease 2
    • TREX 2
    • TREX2
    • TREX2_HUMAN
    see all
  • FunctionExonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.
  • Tissue specificityDetected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
  • Sequence similaritiesBelongs to the exonuclease superfamily. TREX family.
  • Cellular localizationNucleus.
  • Information by UniProt

References for Recombinant Human TREX2 protein (ab124849)

ab124849 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"